PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00872.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 157aa    MW: 18191.6 Da    PI: 10.343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00872.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-18449147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  rg W + Ede+l+++v+++G+++W++Ia+++  gR++k+c++rw++ 
  Zmw_sc00872.1.g00010.1.am.mk  4 RGHWRPSEDEKLKELVALYGPHNWNAIAEKLK-GRSGKSCRLRWFNQ 49
                                  899****************************9.***********996 PP

2Myb_DNA-binding52.79.9e-175699146
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                  r ++++eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Zmw_sc00872.1.g00010.1.am.mk 56 RSPFSEEEEELLLASHRVHGNR-WAVIARFFP-GRTDNAVKNHWHV 99
                                  789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.906154IPR017930Myb domain
SMARTSM007172.1E-15352IPR001005SANT/Myb domain
PfamPF002499.3E-18449IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-27557IPR009057Homeodomain-like
CDDcd001677.83E-14748No hitNo description
PROSITE profilePS5129419.73555105IPR017930Myb domain
SMARTSM007174.1E-1555103IPR001005SANT/Myb domain
PfamPF002495.0E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2058104IPR009057Homeodomain-like
CDDcd001674.85E-67198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVA LYGPHNWNAI AEKLKGRSGK SCRLRWFNQL DPRINRSPFS  60
EEEEELLLAS HRVHGNRWAV IARFFPGRTD NAVKNHWHVI MARRCRERAR MSNRPQCGAA  120
AGTTMENDNT CRNAKKPRPD DANCLASLVD KHRSEFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3421055108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644561.15e-85PREDICTED: transcriptional activator Myb-like isoform X3
SwissprotQ9FDW13e-38MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A060D7S35e-85A0A060D7S3_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G455869_P012e-84(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260